SCOPe 2.08: Domain d2occj_: 2occ J:

Lineage for d2occj_ (2occ J:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family)
   automatically mapped to Pfam PF02238

5. Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81416] (56 PDB entries)

8. Domain d2occj_: 2occ J: [43524]
   Other proteins in same PDB: d2occa_, d2occb1, d2occb2, d2occc_, d2occd_, d2occe_, d2occf_, d2occg_, d2occh_, d2occi_, d2occk_, d2occl_, d2occm_, d2occn_, d2occo1, d2occo2, d2occp_, d2occq_, d2occr_, d2occs_, d2occt_, d2occu_, d2occv_, d2occx_, d2occy_, d2occz_
   complexed with cu, hea, mg, na, per, zn

Details for d2occj_

PDB Entry: 2occ, 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state

PDB Compounds: (J:) cytochrome c oxidase

SCOPe Domain Sequences for d2occj_:

Sequence; same for both SEQRES and ATOM records:

>d2occj_ f.23.4.1 (J:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk

Timeline for d2occj_:

• d2occj_ first appeared (with stable ids) in SCOP 1.55, called d2occj1
  
• d2occj_ appears in SCOPe 2.07