![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) ![]() automatically mapped to Pfam PF02937 |
![]() | Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein) |
![]() | Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81412] (37 PDB entries) |
![]() | Domain d2occi_: 2occ I: [43523] Other proteins in same PDB: d2occa_, d2occb1, d2occb2, d2occc_, d2occd_, d2occe_, d2occf_, d2occg_, d2occh_, d2occj_, d2occk_, d2occl_, d2occm_, d2occn_, d2occo1, d2occo2, d2occp_, d2occq_, d2occr_, d2occs_, d2occt_, d2occu_, d2occw_, d2occx_, d2occy_, d2occz_ complexed with cu, hea, mg, na, per, zn |
PDB Entry: 2occ (more details), 2.3 Å
SCOPe Domain Sequences for d2occi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2occi_ f.23.3.1 (I:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]} stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf eemrkagifqsak
Timeline for d2occi_:
![]() Domains from other chains: (mouse over for more information) d2occa_, d2occb1, d2occb2, d2occc_, d2occd_, d2occe_, d2occf_, d2occg_, d2occh_, d2occj_, d2occk_, d2occl_, d2occm_, d2occn_, d2occo1, d2occo2, d2occp_, d2occq_, d2occr_, d2occs_, d2occt_, d2occu_, d2occv_, d2occw_, d2occx_, d2occy_, d2occz_ |