Lineage for d2occb2 (2occ B:1-90)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456154Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
    two antiparallel transmembrane helices
  4. 1456176Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 1456177Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 1456219Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 1456220Species Cow (Bos taurus) [TaxId:9913] [81454] (24 PDB entries)
  8. 1456253Domain d2occb2: 2occ B:1-90 [43519]
    Other proteins in same PDB: d2occa_, d2occb1, d2occc_, d2occd_, d2occe_, d2occf_, d2occg_, d2occh_, d2occi_, d2occj_, d2occk_, d2occl_, d2occm_, d2occn_, d2occo1, d2occp_, d2occq_, d2occr_, d2occs_, d2occt_, d2occu_, d2occv_, d2occw_, d2occx_, d2occy_, d2occz_
    complexed with cu, hea, mg, na, per, zn

Details for d2occb2

PDB Entry: 2occ (more details), 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state
PDB Compounds: (B:) cytochrome c oxidase

SCOPe Domain Sequences for d2occb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2occb2 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d2occb2:

Click to download the PDB-style file with coordinates for d2occb2.
(The format of our PDB-style files is described here.)

Timeline for d2occb2: