SCOP 1.69: Domain d2occb2: 2occ B:1-90

Lineage for d2occb2 (2occ B:1-90)

1. Root: SCOP 1.69

2. Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (2 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)

6. Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81454] (7 PDB entries)

8. Domain d2occb2: 2occ B:1-90 [43519]
   Other proteins in same PDB: d2occa_, d2occb1, d2occc_, d2occd_, d2occe_, d2occf_, d2occg_, d2occh_, d2occi_, d2occj_, d2occk_, d2occl_, d2occm_, d2occn_, d2occo1, d2occp_, d2occq_, d2occr_, d2occs_, d2occt_, d2occu_, d2occv_, d2occw_, d2occx_, d2occy_, d2occz_

Details for d2occb2

PDB Entry: 2occ, 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d2occb2:

Sequence; same for both SEQRES and ATOM records:

>d2occb2 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus)}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

Timeline for d2occb2:

• d2occb2 first appeared (with stable ids) in SCOP 1.55
  
• d2occb2 appears in SCOP 1.67
  
• d2occb2 appears in SCOP 1.71
  
• d2occb2 appears in the current release, SCOPe 2.08