Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) |
Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
Superfamily f.2.1: Membrane all-alpha [56869] (10 families) |
Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein) |
Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species) |
Species Thermochromatium tepidum [TaxId:1050] [56882] (1 PDB entry) |
Domain d1eysl1: 1eys L: [43515] Other proteins in same PDB: d1eysc_, d1eysh1 |
PDB Entry: 1eys (more details), 2.2 Å
SCOP Domain Sequences for d1eysl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eysl1 f.2.1.2 (L:) Photosynthetic reaction centre, L-, M- and H-chains {Thermochromatium tepidum} amlsfekkyrvrggtliggdlfdfwvgpfyvgffgvvgfcftllgvllivwgatigptgp tsdlqtynlwrisiappdlsyglrmapltegglwqiiticaagafiswalreveicrklg igfhvpfafsfaigaylvlvfvrpllmgawghgfpygilshldwvsnvgyqflhfhynpa hmlaisffftnclalsmhgslilsvtnpqrgepvktsehentffrdivgysigalaihrl glflalsaafwsavcilisgpfwtrgwpewwnwwlelplw
Timeline for d1eysl1:
View in 3D Domains from other chains: (mouse over for more information) d1eysc_, d1eysh1, d1eysh2, d1eysm1 |