Class f: Membrane and cell surface proteins and peptides [56835] (42 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins) L and M are probably related to each other |
Protein M (medium) subunit [81481] (3 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [81479] (38 PDB entries) |
Domain d4rcrm_: 4rcr M: [43513] Other proteins in same PDB: d4rcrh1, d4rcrh2, d4rcrl_ complexed with bcl, bog, bph, fe, u10 |
PDB Entry: 4rcr (more details), 2.8 Å
SCOP Domain Sequences for d4rcrm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rcrm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides} ifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfsglm wfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffmfva vwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifshldw tnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrgtaa eraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh
Timeline for d4rcrm_: