Lineage for d4rcrm_ (4rcr M:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268375Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 268376Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 268377Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
    L and M are probably related to each other
  6. 268426Protein M (medium) subunit [81481] (3 species)
  7. 268427Species Rhodobacter sphaeroides [TaxId:1063] [81479] (29 PDB entries)
  8. 268462Domain d4rcrm_: 4rcr M: [43513]
    Other proteins in same PDB: d4rcrh1, d4rcrh2, d4rcrl_
    complexed with bcl, bog, bph, fe, u10

Details for d4rcrm_

PDB Entry: 4rcr (more details), 2.8 Å

PDB Description: structure of the reaction center from rhodobacter sphaeroides r-26 and 2.4.1: protein-cofactor (bacteriochlorophyll, bacteriopheophytin, and carotenoid) interactions
PDB Compounds: (M:)

SCOP Domain Sequences for d4rcrm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rcrm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides}
ifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfsglm
wfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffmfva
vwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifshldw
tnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrgtaa
eraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh

SCOP Domain Coordinates for d4rcrm_:

Click to download the PDB-style file with coordinates for d4rcrm_.
(The format of our PDB-style files is described here.)

Timeline for d4rcrm_: