SCOP 1.63: Domain d4rcrm_: 4rcr M:

Lineage for d4rcrm_ (4rcr M:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (29 PDB entries)

8. Domain d4rcrm_: 4rcr M: [43513]
   Other proteins in same PDB: d4rcrh1, d4rcrh2, d4rcrl_
   complexed with bcl, bog, bph, fe, u10

Details for d4rcrm_

PDB Entry: 4rcr, 2.8 Å

PDB Description: structure of the reaction center from rhodobacter sphaeroides r-26 and 2.4.1: protein-cofactor (bacteriochlorophyll, bacteriopheophytin, and carotenoid) interactions

SCOP Domain Sequences for d4rcrm_:

Sequence; same for both SEQRES and ATOM records:

>d4rcrm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides}
ifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfsglm
wfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffmfva
vwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifshldw
tnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrgtaa
eraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh

Timeline for d4rcrm_:

• d4rcrm_ first appeared (with stable ids) in SCOP 1.55, called d4rcrm1
  
• d4rcrm_ was called d4rcrm1 in SCOP 1.61
  
• d4rcrm_ appears in SCOP 1.65
  
• d4rcrm_ appears in the current release, SCOPe 2.08