SCOPe 2.08: Domain d1ystm_: 1yst M:

Lineage for d1ystm_ (1yst M:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (65 PDB entries)
   Uniprot P02953

8. Domain d1ystm_: 1yst M: [43510]
   Other proteins in same PDB: d1ysth1, d1ysth2, d1ystl_
   complexed with bcl, bph, mn, spo, u10

Details for d1ystm_

PDB Entry: 1yst, 3 Å

PDB Description: structure of the photochemical reaction center of a spheroidene containing purple bacterium, rhodobacter sphaeroides y, at 3 angstroms resolution

PDB Compounds: (M:) photosynthetic reaction center (m subunit)

SCOPe Domain Sequences for d1ystm_:

Sequence; same for both SEQRES and ATOM records:

>d1ystm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqamgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hgmap

Timeline for d1ystm_:

• d1ystm_ first appeared (with stable ids) in SCOP 1.55, called d1ystm1
  
• d1ystm_ appears in SCOPe 2.07