Lineage for d1ystl_ (1yst L:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2579766Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2579767Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2579768Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2579769Protein L (light) subunit [81477] (3 species)
  7. 2579770Species Rhodobacter sphaeroides [TaxId:1063] [81475] (62 PDB entries)
    Uniprot P02954
  8. 2579838Domain d1ystl_: 1yst L: [43509]
    Other proteins in same PDB: d1ysth1, d1ysth2, d1ystm_
    complexed with bcl, bph, mn, spo, u10

Details for d1ystl_

PDB Entry: 1yst (more details), 3 Å

PDB Description: structure of the photochemical reaction center of a spheroidene containing purple bacterium, rhodobacter sphaeroides y, at 3 angstroms resolution
PDB Compounds: (L:) photosynthetic reaction center (l subunit)

SCOPe Domain Sequences for d1ystl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ystl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwa

SCOPe Domain Coordinates for d1ystl_:

Click to download the PDB-style file with coordinates for d1ystl_.
(The format of our PDB-style files is described here.)

Timeline for d1ystl_: