Lineage for d2rcrh2 (2rcr H:1-35)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1957878Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) (S)
  5. 1957879Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)
  6. 1957880Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species)
  7. 1957881Species Rhodobacter sphaeroides [TaxId:1063] [81486] (83 PDB entries)
    Uniprot P11846
  8. 1957970Domain d2rcrh2: 2rcr H:1-35 [43508]
    Other proteins in same PDB: d2rcrh1, d2rcrl_, d2rcrm_
    complexed with bcl, bph, fe, uq

Details for d2rcrh2

PDB Entry: 2rcr (more details), 3.1 Å

PDB Description: structure of the membrane-bound protein photosynthetic reaction center from rhodobacter sphaeroides
PDB Compounds: (H:) photosynthetic reaction center (h subunit)

SCOPe Domain Sequences for d2rcrh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rcrh2 f.23.10.1 (H:1-35) Photosystem II reaction centre subunit H, transmembrane region {Rhodobacter sphaeroides [TaxId: 1063]}
mvgvtafgnfdlaslaiysfwiflagliyylqten

SCOPe Domain Coordinates for d2rcrh2:

Click to download the PDB-style file with coordinates for d2rcrh2.
(The format of our PDB-style files is described here.)

Timeline for d2rcrh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rcrh1