Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) |
Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
Superfamily f.2.1: Membrane all-alpha [56869] (10 families) |
Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein) |
Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [56881] (23 PDB entries) |
Domain d2rcrh2: 2rcr H:1-35 [43508] Other proteins in same PDB: d2rcrh1 |
PDB Entry: 2rcr (more details), 3.1 Å
SCOP Domain Sequences for d2rcrh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rcrh2 f.2.1.2 (H:1-35) Photosynthetic reaction centre, L-, M- and H-chains {Rhodobacter sphaeroides} mvgvtafgnfdlaslaiysfwiflagliyylqten
Timeline for d2rcrh2: