Lineage for d1pstm_ (1pst M:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268375Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 268376Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 268377Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
    L and M are probably related to each other
  6. 268426Protein M (medium) subunit [81481] (3 species)
  7. 268427Species Rhodobacter sphaeroides [TaxId:1063] [81479] (29 PDB entries)
  8. 268456Domain d1pstm_: 1pst M: [43504]
    Other proteins in same PDB: d1psth1, d1psth2, d1pstl_
    complexed with bcl, bph, crt, fe, u10; mutant

Details for d1pstm_

PDB Entry: 1pst (more details), 3 Å

PDB Description: crystallographic analyses of site-directed mutants of the photosynthetic reaction center from rhodobacter sphaeroides

SCOP Domain Sequences for d1pstm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pstm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides}
ifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfsglm
wfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffmfva
vwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifshldw
tnnfslvhgnlfynpflglsiaflygsallfamhgatilavsrfggereleqiadrgtaa
eraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh

SCOP Domain Coordinates for d1pstm_:

Click to download the PDB-style file with coordinates for d1pstm_.
(The format of our PDB-style files is described here.)

Timeline for d1pstm_: