SCOP 1.75: Domain d1pssl_: 1pss L:

Lineage for d1pssl_ (1pss L:)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (4 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (67 PDB entries)
   Uniprot P02954

8. Domain d1pssl_: 1pss L: [43500]
   Other proteins in same PDB: d1pssh1, d1pssh2, d1pssm_
   complexed with bcl, bph, crt, fe, u10

Details for d1pssl_

PDB Entry: 1pss, 3 Å

PDB Description: crystallographic analyses of site-directed mutants of the photosynthetic reaction center from rhodobacter sphaeroides

PDB Compounds: (L:) photosynthetic reaction center

SCOP Domain Sequences for d1pssl_:

Sequence; same for both SEQRES and ATOM records:

>d1pssl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
ferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwnpqli
svyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfafafa
ilayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisffftna
lalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsavffs
alcmiitgtiwfdqwvdwwqwwvklp

Timeline for d1pssl_:

• d1pssl_ first appeared (with stable ids) in SCOP 1.55, called d1pssl1
  
• d1pssl_ appears in SCOP 1.73
  
• d1pssl_ appears in SCOPe 2.01
  
• d1pssl_ appears in the current release, SCOPe 2.08