SCOP 1.75: Domain d1pcrl_: 1pcr L:

Lineage for d1pcrl_ (1pcr L:)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (4 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (67 PDB entries)
   Uniprot P02954

8. Domain d1pcrl_: 1pcr L: [43494]
   Other proteins in same PDB: d1pcrh1, d1pcrh2, d1pcrm_
   complexed with bcl, bph, fe, lda, po4, spo, u10

Details for d1pcrl_

PDB Entry: 1pcr, 2.65 Å

PDB Description: structure of the photosynthetic reaction centre from rhodobacter sphaeroides at 2.65 angstroms resolution: cofactors and protein-cofactor interactions

PDB Compounds: (L:) photosynthetic reaction center

SCOP Domain Sequences for d1pcrl_:

Sequence; same for both SEQRES and ATOM records:

>d1pcrl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d1pcrl_:

• d1pcrl_ first appeared (with stable ids) in SCOP 1.55, called d1pcrl1
  
• d1pcrl_ appears in SCOP 1.73
  
• d1pcrl_ appears in SCOPe 2.01
  
• d1pcrl_ appears in the current release, SCOPe 2.08