Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein L (light) subunit [81477] (3 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [81475] (56 PDB entries) Uniprot P02954 |
Domain d1aign_: 1aig N: [43485] Other proteins in same PDB: d1aigh1, d1aigh2, d1aigm_, d1aigo_, d1aigp1, d1aigp2 complexed with bcl, bph, fe2, u10 |
PDB Entry: 1aig (more details), 2.6 Å
SCOPe Domain Sequences for d1aign_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aign_ f.26.1.1 (N:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]} allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
Timeline for d1aign_: