Lineage for d1aigm_ (1aig M:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1958788Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1958789Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 1958790Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1958875Protein M (medium) subunit [81481] (3 species)
  7. 1958876Species Rhodobacter sphaeroides [TaxId:1063] [81479] (60 PDB entries)
    Uniprot P02953
  8. 1958909Domain d1aigm_: 1aig M: [43483]
    Other proteins in same PDB: d1aigh1, d1aigh2, d1aigl_, d1aign_, d1aigp1, d1aigp2
    complexed with bcl, bph, fe2, u10

Details for d1aigm_

PDB Entry: 1aig (more details), 2.6 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the d+qb-charge separated state
PDB Compounds: (M:) photosynthetic reaction center (m subunit)

SCOPe Domain Sequences for d1aigm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aigm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
yqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlslfs
glmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasffm
fvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygifsh
ldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiadrg
taaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqnh

SCOPe Domain Coordinates for d1aigm_:

Click to download the PDB-style file with coordinates for d1aigm_.
(The format of our PDB-style files is described here.)

Timeline for d1aigm_: