Lineage for d1aigl_ (1aig L:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268375Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 268376Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 268377Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
    L and M are probably related to each other
  6. 268378Protein L (light) subunit [81477] (3 species)
  7. 268379Species Rhodobacter sphaeroides [TaxId:1063] [81475] (29 PDB entries)
  8. 268392Domain d1aigl_: 1aig L: [43482]
    Other proteins in same PDB: d1aigh1, d1aigh2, d1aigm_, d1aigo_, d1aigp1, d1aigp2

Details for d1aigl_

PDB Entry: 1aig (more details), 2.6 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the d+qb-charge separated state

SCOP Domain Sequences for d1aigl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aigl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOP Domain Coordinates for d1aigl_:

Click to download the PDB-style file with coordinates for d1aigl_.
(The format of our PDB-style files is described here.)

Timeline for d1aigl_: