Lineage for d1mpsl_ (1mps L:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1958788Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1958789Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 1958790Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1958791Protein L (light) subunit [81477] (3 species)
  7. 1958792Species Rhodobacter sphaeroides [TaxId:1063] [81475] (61 PDB entries)
    Uniprot P02954
  8. 1958810Domain d1mpsl_: 1mps L: [43467]
    Other proteins in same PDB: d1mpsh1, d1mpsh2, d1mpsm_
    complexed with bcl, bph, fe2, lda, po4, spn, u10; mutant

Details for d1mpsl_

PDB Entry: 1mps (more details), 2.55 Å

PDB Description: photosynthetic reaction center mutant with phe m 197 replaced with arg and tyr m 177 replaced with phe (chain m, y177f, f197r)
PDB Compounds: (L:) photosynthetic reaction center

SCOPe Domain Sequences for d1mpsl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mpsl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d1mpsl_:

Click to download the PDB-style file with coordinates for d1mpsl_.
(The format of our PDB-style files is described here.)

Timeline for d1mpsl_: