SCOP 1.65: Domain d1aijm_: 1aij M:

Lineage for d1aijm_ (1aij M:)

1. Root: SCOP 1.65

2. Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (29 PDB entries)

8. Domain d1aijm_: 1aij M: [43462]
   Other proteins in same PDB: d1aijh1, d1aijh2, d1aijl_, d1aijr_, d1aijt1, d1aijt2

Details for d1aijm_

PDB Entry: 1aij, 2.2 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state

SCOP Domain Sequences for d1aijm_:

Sequence; same for both SEQRES and ATOM records:

>d1aijm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
h

Timeline for d1aijm_:

• d1aijm_ first appeared (with stable ids) in SCOP 1.55, called d1aijm1
  
• d1aijm_ appears in SCOP 1.63
  
• d1aijm_ appears in SCOP 1.67
  
• d1aijm_ appears in the current release, SCOPe 2.08