Lineage for d1e6dm_ (1e6d M:)

  1. Root: SCOP 1.67
  2. 425432Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)
  3. 426657Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 426658Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 426659Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
    L and M are probably related to each other
  6. 426720Protein M (medium) subunit [81481] (3 species)
  7. 426721Species Rhodobacter sphaeroides [TaxId:1063] [81479] (38 PDB entries)
  8. 426725Domain d1e6dm_: 1e6d M: [43459]
    Other proteins in same PDB: d1e6dh1, d1e6dh2, d1e6dl_
    complexed with bcl, bph, fe, lda, po4, spn, u10; mutant

Details for d1e6dm_

PDB Entry: 1e6d (more details), 2.3 Å

PDB Description: photosynthetic reaction center mutant with trp m115 replaced with phe (chain m, wm115f) phe m197 replaced with arg (chain m, fm197r)

SCOP Domain Sequences for d1e6dm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6dm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglfliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlrynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

SCOP Domain Coordinates for d1e6dm_:

Click to download the PDB-style file with coordinates for d1e6dm_.
(The format of our PDB-style files is described here.)

Timeline for d1e6dm_: