Lineage for d1e6dl_ (1e6d L:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1457799Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1457800Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 1457801Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1457802Protein L (light) subunit [81477] (3 species)
  7. 1457803Species Rhodobacter sphaeroides [TaxId:1063] [81475] (56 PDB entries)
    Uniprot P02954
  8. 1457809Domain d1e6dl_: 1e6d L: [43458]
    Other proteins in same PDB: d1e6dh1, d1e6dh2, d1e6dm_
    complexed with bcl, bph, fe, lda, po4, spn, u10; mutant

Details for d1e6dl_

PDB Entry: 1e6d (more details), 2.3 Å

PDB Description: photosynthetic reaction center mutant with trp m115 replaced with phe (chain m, wm115f) phe m197 replaced with arg (chain m, fm197r)
PDB Compounds: (L:) Photosynthetic reaction center L subunit

SCOPe Domain Sequences for d1e6dl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6dl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d1e6dl_:

Click to download the PDB-style file with coordinates for d1e6dl_.
(The format of our PDB-style files is described here.)

Timeline for d1e6dl_: