SCOPe 2.06: Domain d1qovm_: 1qov M:

Lineage for d1qovm_ (1qov M:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (60 PDB entries)
   Uniprot P02953

8. Domain d1qovm_: 1qov M: [43456]
   Other proteins in same PDB: d1qovh1, d1qovh2, d1qovl_
   complexed with bcl, bph, cdl, cl, fe2, spn, u10; mutant

Details for d1qovm_

PDB Entry: 1qov, 2.1 Å

PDB Description: photosynthetic reaction center mutant with ala m260 replaced with trp (chain m, a260w)

PDB Compounds: (M:) photosynthetic reaction center

SCOPe Domain Sequences for d1qovm_:

Sequence; same for both SEQRES and ATOM records:

>d1qovm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnwtmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d1qovm_:

• d1qovm_ first appeared (with stable ids) in SCOP 1.55, called d1qovm1
  
• d1qovm_ appears in SCOPe 2.05
  
• d1qovm_ appears in SCOPe 2.07
  
• d1qovm_ appears in the current release, SCOPe 2.08