Lineage for d1qovm1 (1qov M:)
- Root: SCOP 1.55
Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) Fold f.2: Membrane all-alpha [56868] (1 superfamily) Superfamily f.2.1: Membrane all-alpha [56869] (10 families) 
Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein) Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species) Species Rhodobacter sphaeroides [TaxId:1063] [56881] (15 PDB entries) 
Domain d1qovm1: 1qov M: [43456]
Other proteins in same PDB: d1qovh1
Details for d1qovm1
PDB Entry: 1qov (more details), 2.1 Å
PDB Description: photosynthetic reaction center mutant with ala m260 replaced with trp (chain m, a260w)
SCOP Domain Sequences for d1qovm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qovm1 f.2.1.2 (M:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodobacter sphaeroides}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnwtmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg
SCOP Domain Coordinates for d1qovm1:
Click to download the PDB-style file with coordinates for d1qovm1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qovm1:
- d1qovm1 appears in SCOP 1.57
- d1qovm1 appears in the current release, SCOPe 2.08, called d1qovm_
View in 3D
