Lineage for d7prch2 (7prc H:1-36)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 340729Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
    not a true fold
  4. 340843Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (1 family) (S)
  5. 340844Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)
  6. 340845Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species)
  7. 340882Species Rhodopseudomonas viridis [TaxId:1079] [81485] (8 PDB entries)
  8. 340890Domain d7prch2: 7prc H:1-36 [43454]
    Other proteins in same PDB: d7prcc_, d7prch1, d7prcl_, d7prcm_
    complexed with 7mq, bcb, bpb, cet, fe2, hem, lda, ns5, so4

Details for d7prch2

PDB Entry: 7prc (more details), 2.65 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (dg-420315 (triazine) complex)

SCOP Domain Sequences for d7prch2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7prch2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

SCOP Domain Coordinates for d7prch2:

Click to download the PDB-style file with coordinates for d7prch2.
(The format of our PDB-style files is described here.)

Timeline for d7prch2: