SCOP 1.75: Domain d7prcl_: 7prc L:

Lineage for d7prcl_ (7prc L:)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (4 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81474] (11 PDB entries)

8. Domain d7prcl_: 7prc L: [43452]
   Other proteins in same PDB: d7prcc_, d7prch1, d7prch2, d7prcm_
   complexed with 7mq, bcb, bpb, cet, fe2, hem, lda, ns5, so4

Details for d7prcl_

PDB Entry: 7prc, 2.65 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (dg-420315 (triazine) complex)

PDB Compounds: (L:) photosynthetic reaction center

SCOP Domain Sequences for d7prcl_:

Sequence; same for both SEQRES and ATOM records:

>d7prcl_ f.26.1.1 (L:) L (light) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

Timeline for d7prcl_:

• d7prcl_ first appeared (with stable ids) in SCOP 1.55, called d7prcl1
  
• d7prcl_ appears in SCOP 1.73
  
• d7prcl_ appears in SCOPe 2.01
  
• d7prcl_ appears in the current release, SCOPe 2.08