Lineage for d7prcl_ (7prc L:)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 341077Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 341078Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 341079Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
    L and M are probably related to each other
  6. 341080Protein L (light) subunit [81477] (3 species)
  7. 341117Species Rhodopseudomonas viridis [TaxId:1079] [81474] (8 PDB entries)
  8. 341125Domain d7prcl_: 7prc L: [43452]
    Other proteins in same PDB: d7prcc_, d7prch1, d7prch2, d7prcm_
    complexed with 7mq, bcb, bpb, cet, fe2, hem, lda, ns5, so4

Details for d7prcl_

PDB Entry: 7prc (more details), 2.65 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (dg-420315 (triazine) complex)
PDB Compounds: (L:)

SCOP Domain Sequences for d7prcl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7prcl_ f.26.1.1 (L:) L (light) subunit {Rhodopseudomonas viridis}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

SCOP Domain Coordinates for d7prcl_:

Click to download the PDB-style file with coordinates for d7prcl_.
(The format of our PDB-style files is described here.)

Timeline for d7prcl_: