Lineage for d4prch2 (4prc H:1-36)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 340729Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
    not a true fold
  4. 340843Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (1 family) (S)
  5. 340844Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)
  6. 340845Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species)
  7. 340882Species Rhodopseudomonas viridis [TaxId:1079] [81485] (8 PDB entries)
  8. 340889Domain d4prch2: 4prc H:1-36 [43451]
    Other proteins in same PDB: d4prcc_, d4prch1, d4prcl_, d4prcm_
    complexed with 7mq, bcb, bpb, fe2, hem, lda, ns5, sma, so4

Details for d4prch2

PDB Entry: 4prc (more details), 2.4 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (stigmatellin complex)
PDB Compounds: (H:)

SCOP Domain Sequences for d4prch2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4prch2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

SCOP Domain Coordinates for d4prch2:

Click to download the PDB-style file with coordinates for d4prch2.
(The format of our PDB-style files is described here.)

Timeline for d4prch2: