Class f: Membrane and cell surface proteins and peptides [56835] (34 folds) |
Fold f.23: Single transmembrane helix [81407] (22 superfamilies) not a true fold |
Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (1 family) |
Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein) |
Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species) |
Species Rhodopseudomonas viridis [TaxId:1079] [81485] (8 PDB entries) |
Domain d4prch2: 4prc H:1-36 [43451] Other proteins in same PDB: d4prcc_, d4prch1, d4prcl_, d4prcm_ complexed with 7mq, bcb, bpb, fe2, hem, lda, ns5, sma, so4 |
PDB Entry: 4prc (more details), 2.4 Å
SCOP Domain Sequences for d4prch2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4prch2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis} myhgalaqhldiaqlvwyaqwlviwtvvllylrred
Timeline for d4prch2: