SCOP 1.65: Domain d2prcl_: 2prc L:

Lineage for d2prcl_ (2prc L:)

1. Root: SCOP 1.65

2. Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81474] (8 PDB entries)

8. Domain d2prcl_: 2prc L: [43446]
   Other proteins in same PDB: d2prcc_, d2prch1, d2prch2, d2prcm_
   complexed with 7mq, bcb, bpb, fe2, hem, lda, ns5, so4, uq2

Details for d2prcl_

PDB Entry: 2prc, 2.45 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (ubiquinone-2 complex)

SCOP Domain Sequences for d2prcl_:

Sequence; same for both SEQRES and ATOM records:

>d2prcl_ f.26.1.1 (L:) L (light) subunit {Rhodopseudomonas viridis}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

Timeline for d2prcl_:

• d2prcl_ first appeared (with stable ids) in SCOP 1.55, called d2prcl1
  
• d2prcl_ appears in SCOP 1.63
  
• d2prcl_ appears in SCOP 1.67
  
• d2prcl_ appears in the current release, SCOPe 2.08