Lineage for d1prch2 (1prc H:1-36)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268041Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
    not a true fold
  4. 268155Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (1 family) (S)
  5. 268156Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)
  6. 268157Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species)
  7. 268194Species Rhodopseudomonas viridis [TaxId:1079] [81485] (8 PDB entries)
  8. 268198Domain d1prch2: 1prc H:1-36 [43445]
    Other proteins in same PDB: d1prcc_, d1prch1, d1prcl_, d1prcm_
    complexed with bcl, bpb, fe, hem, lda, mq7, ns1, so4, uq1

Details for d1prch2

PDB Entry: 1prc (more details), 2.3 Å

PDB Description: crystallographic refinement at 2.3 angstroms resolution and refined model of the photosynthetic reaction center from rhodopseudomonas viridis

SCOP Domain Sequences for d1prch2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1prch2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

SCOP Domain Coordinates for d1prch2:

Click to download the PDB-style file with coordinates for d1prch2.
(The format of our PDB-style files is described here.)

Timeline for d1prch2: