Lineage for d1prch2 (1prc H:1-36)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2578573Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) (S)
  5. 2578574Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)
  6. 2578575Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (4 species)
  7. 2578671Species Rhodopseudomonas viridis [TaxId:1079] [81485] (19 PDB entries)
    synonym: blastochloris viridis
  8. 2578685Domain d1prch2: 1prc H:1-36 [43445]
    Other proteins in same PDB: d1prcc_, d1prch1, d1prcl_, d1prcm_
    complexed with bcb, bpb, fe, hem, lda, mq7, ns1, so4, uq1

Details for d1prch2

PDB Entry: 1prc (more details), 2.3 Å

PDB Description: crystallographic refinement at 2.3 angstroms resolution and refined model of the photosynthetic reaction center from rhodopseudomonas viridis
PDB Compounds: (H:) photosynthetic reaction center

SCOPe Domain Sequences for d1prch2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1prch2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

SCOPe Domain Coordinates for d1prch2:

Click to download the PDB-style file with coordinates for d1prch2.
(The format of our PDB-style files is described here.)

Timeline for d1prch2: