SCOP 1.75: Domain d1prcm_: 1prc M:

Lineage for d1prcm_ (1prc M:)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (4 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81478] (11 PDB entries)

8. Domain d1prcm_: 1prc M: [43444]
   Other proteins in same PDB: d1prcc_, d1prch1, d1prch2, d1prcl_
   complexed with bcl, bpb, fe, hem, lda, mq7, ns1, so4, uq1

Details for d1prcm_

PDB Entry: 1prc, 2.3 Å

PDB Description: crystallographic refinement at 2.3 angstroms resolution and refined model of the photosynthetic reaction center from rhodopseudomonas viridis

PDB Compounds: (M:) photosynthetic reaction center

SCOP Domain Sequences for d1prcm_:

Sequence; same for both SEQRES and ATOM records:

>d1prcm_ f.26.1.1 (M:) M (medium) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

Timeline for d1prcm_:

• d1prcm_ first appeared (with stable ids) in SCOP 1.55, called d1prcm1
  
• d1prcm_ appears in SCOP 1.73
  
• d1prcm_ appears in SCOPe 2.01
  
• d1prcm_ appears in the current release, SCOPe 2.08