Lineage for d5prch2 (5prc H:1-36)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254169Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) (S)
  5. 2254170Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)
  6. 2254171Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (4 species)
  7. 2254267Species Rhodopseudomonas viridis [TaxId:1079] [81485] (19 PDB entries)
    synonym: blastochloris viridis
  8. 2254276Domain d5prch2: 5prc H:1-36 [43442]
    Other proteins in same PDB: d5prcc_, d5prch1, d5prcl_, d5prcm_
    complexed with atz, bcb, bpb, fe2, hem, lda, mq7, ns5, so4

Details for d5prch2

PDB Entry: 5prc (more details), 2.35 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (atrazine complex)
PDB Compounds: (H:) photosynthetic reaction center

SCOPe Domain Sequences for d5prch2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5prch2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

SCOPe Domain Coordinates for d5prch2:

Click to download the PDB-style file with coordinates for d5prch2.
(The format of our PDB-style files is described here.)

Timeline for d5prch2: