SCOP 1.65: Domain d5prcl_: 5prc L:

Lineage for d5prcl_ (5prc L:)

1. Root: SCOP 1.65

2. Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81474] (8 PDB entries)

8. Domain d5prcl_: 5prc L: [43440]
   Other proteins in same PDB: d5prcc_, d5prch1, d5prch2, d5prcm_
   complexed with 7mq, atz, bcb, bpb, fe2, hem, lda, ns5, so4

Details for d5prcl_

PDB Entry: 5prc, 2.35 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (atrazine complex)

SCOP Domain Sequences for d5prcl_:

Sequence; same for both SEQRES and ATOM records:

>d5prcl_ f.26.1.1 (L:) L (light) subunit {Rhodopseudomonas viridis}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

Timeline for d5prcl_:

• d5prcl_ first appeared (with stable ids) in SCOP 1.55, called d5prcl1
  
• d5prcl_ appears in SCOP 1.63
  
• d5prcl_ appears in SCOP 1.67
  
• d5prcl_ appears in the current release, SCOPe 2.08