Class f: Membrane and cell surface proteins and peptides [56835] (34 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins) L and M are probably related to each other |
Protein L (light) subunit [81477] (3 species) |
Species Rhodopseudomonas viridis [TaxId:1079] [81474] (8 PDB entries) |
Domain d5prcl_: 5prc L: [43440] Other proteins in same PDB: d5prcc_, d5prch1, d5prch2, d5prcm_ complexed with 7mq, atz, bcb, bpb, fe2, hem, lda, ns5, so4 |
PDB Entry: 5prc (more details), 2.35 Å
SCOP Domain Sequences for d5prcl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5prcl_ f.26.1.1 (L:) L (light) subunit {Rhodopseudomonas viridis} allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni fltgafgtiasgpfwtrgwpewwgwwldipfws
Timeline for d5prcl_:
View in 3D Domains from other chains: (mouse over for more information) d5prcc_, d5prch1, d5prch2, d5prcm_ |