SCOP 1.55: Domain d5prcl1: 5prc L:

Lineage for d5prcl1 (5prc L:)

1. Root: SCOP 1.55

2. Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (10 families)

5. Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)

6. Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [56880] (8 PDB entries)

8. Domain d5prcl1: 5prc L: [43440]
   Other proteins in same PDB: d5prcc_, d5prch1

Details for d5prcl1

PDB Entry: 5prc, 2.35 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (atrazine complex)

SCOP Domain Sequences for d5prcl1:

Sequence; same for both SEQRES and ATOM records:

>d5prcl1 f.2.1.2 (L:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodopseudomonas viridis}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

Timeline for d5prcl1:

• d5prcl1 appears in SCOP 1.57
  
• d5prcl1 appears in the current release, SCOPe 2.08, called d5prcl_