Lineage for d3prch2 (3prc H:1-36)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1698094Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) (S)
  5. 1698095Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)
  6. 1698096Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species)
  7. 1698189Species Rhodopseudomonas viridis [TaxId:1079] [81485] (15 PDB entries)
    synonym: blastochloris viridis
  8. 1698200Domain d3prch2: 3prc H:1-36 [43439]
    Other proteins in same PDB: d3prcc_, d3prch1, d3prcl_, d3prcm_
    complexed with bcb, bpb, fe2, hem, lda, mq7, ns5, so4

Details for d3prch2

PDB Entry: 3prc (more details), 2.4 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (qb-depleted)
PDB Compounds: (H:) photosynthetic reaction center

SCOPe Domain Sequences for d3prch2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3prch2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

SCOPe Domain Coordinates for d3prch2:

Click to download the PDB-style file with coordinates for d3prch2.
(The format of our PDB-style files is described here.)

Timeline for d3prch2: