SCOP 1.65: Domain d1dxrh2: 1dxr H:1-36

Lineage for d1dxrh2 (1dxr H:1-36)

1. Root: SCOP 1.65

2. Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)

3. Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
   not a true fold

4. Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (1 family)

5. Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)

6. Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81485] (8 PDB entries)

8. Domain d1dxrh2: 1dxr H:1-36 [43433]
   Other proteins in same PDB: d1dxrc_, d1dxrh1, d1dxrl_, d1dxrm_
   complexed with bcb, bpb, fe2, hec, lda, mq9, mst, ns5, so4; mutant

Details for d1dxrh2

PDB Entry: 1dxr, 2 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis - his l168 phe mutant (terbutryn complex)

SCOP Domain Sequences for d1dxrh2:

Sequence; same for both SEQRES and ATOM records:

>d1dxrh2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

Timeline for d1dxrh2:

• d1dxrh2 first appeared (with stable ids) in SCOP 1.55
  
• d1dxrh2 appears in SCOP 1.63
  
• d1dxrh2 appears in SCOP 1.67
  
• d1dxrh2 appears in the current release, SCOPe 2.08