Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) |
Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
Superfamily f.2.1: Membrane all-alpha [56869] (10 families) |
Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein) |
Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species) |
Species Rhodopseudomonas viridis [TaxId:1079] [56880] (8 PDB entries) |
Domain d1dxrh2: 1dxr H:1-36 [43433] Other proteins in same PDB: d1dxrc_, d1dxrh1 |
PDB Entry: 1dxr (more details), 2 Å
SCOP Domain Sequences for d1dxrh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dxrh2 f.2.1.2 (H:1-36) Photosynthetic reaction centre, L-, M- and H-chains {Rhodopseudomonas viridis} myhgalaqhldiaqlvwyaqwlviwtvvllylrred
Timeline for d1dxrh2: