SCOP 1.61: Domain d1e12a_: 1e12 A:

Lineage for d1e12a_ (1e12 A:)

1. Root: SCOP 1.61

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (13 families)

5. Family f.2.1.1: Seven-helix membrane receptors [56870] (4 proteins)

6. Protein Halorhodopsin [56874] (1 species)

7. Species Halobacterium salinarum [TaxId:2242] [56875] (1 PDB entry)

8. Domain d1e12a_: 1e12 A: [43428]

Details for d1e12a_

PDB Entry: 1e12, 1.8 Å

PDB Description: halorhodopsin, a light-driven chloride pump

SCOP Domain Sequences for d1e12a_:

Sequence; same for both SEQRES and ATOM records:

>d1e12a_ f.2.1.1 (A:) Halorhodopsin {Halobacterium salinarum}
renallssslwvnvalagiailvfvymgrtirpgrprliwgatlmiplvsissylgllsg
ltvgmiempaghalagemvrsqwgryltwalstpmillalglladvdlgslftviaadig
mcvtglaaamttsallfrwafyaiscaffvvvlsalvtdwaasassagtaeifdtlrvlt
vvlwlgypivwavgveglalvqsvgatswaysvldvfakyvfafillrwvannertvav

Timeline for d1e12a_:

• d1e12a_ first appeared (with stable ids) in SCOP 1.55
  
• d1e12a_ appears in SCOP 1.59
  
• d1e12a_ appears in SCOP 1.63
  
• d1e12a_ appears in the current release, SCOPe 2.08