Lineage for d1at9__ (1at9 -)
- Root: SCOP 1.61
Class f: Membrane and cell surface proteins and peptides [56835] (12 folds) 
Fold f.2: Membrane all-alpha [56868] (1 superfamily) Superfamily f.2.1: Membrane all-alpha [56869] (13 families) 
Family f.2.1.1: Seven-helix membrane receptors [56870] (4 proteins) Protein Bacteriorhodopsin [56871] (2 species) Species Halobacterium salinarum [TaxId:2242] [56873] (26 PDB entries) 
Domain d1at9__: 1at9 - [43424]
Details for d1at9__
PDB Entry: 1at9 (more details), 3 Å
PDB Description: structure of bacteriorhodopsin at 3.0 angstrom determined by electron crystallography
SCOP Domain Sequences for d1at9__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1at9__ f.2.1.1 (-) Bacteriorhodopsin {Halobacterium salinarum}
aqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsml
lgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigt
glvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvl
wsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg
SCOP Domain Coordinates for d1at9__:
Click to download the PDB-style file with coordinates for d1at9__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1at9__:
- d1at9__ first appeared (with stable ids) in SCOP 1.55
- d1at9__ appears in SCOP 1.59
- d1at9__ appears in SCOP 1.63
- d1at9__ appears in the current release, SCOPe 2.08, called d1at9a_
View in 3D