Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) Pfam PF13853. Phylogeny described in PubMed 12761335 |
Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins) |
Protein Bacteriorhodopsin [56871] (3 species) a light-driven proton pump |
Species Halobacterium salinarum [TaxId:2242] [56873] (118 PDB entries) Uniprot P02945 17-245 |
Domain d1brrc_: 1brr C: [43423] complexed with arc, bgc, gol, oct, ret |
PDB Entry: 1brr (more details), 2.9 Å
SCOPe Domain Sequences for d1brrc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1brrc_ f.13.1.1 (C:) Bacteriorhodopsin {Halobacterium salinarum [TaxId: 2242]} eaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsm llgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimig tglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvv lwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifge
Timeline for d1brrc_: