Lineage for d1ap9__ (1ap9 -)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 201495Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 201496Superfamily f.2.1: Membrane all-alpha [56869] (13 families) (S)
  5. 201497Family f.2.1.1: Seven-helix membrane receptors [56870] (4 proteins)
  6. 201498Protein Bacteriorhodopsin [56871] (2 species)
  7. 201503Species Halobacterium salinarum [TaxId:2242] [56873] (26 PDB entries)
  8. 201524Domain d1ap9__: 1ap9 - [43418]

Details for d1ap9__

PDB Entry: 1ap9 (more details), 2.35 Å

PDB Description: x-ray structure of bacteriorhodopsin from microcrystals grown in lipidic cubic phases

SCOP Domain Sequences for d1ap9__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ap9__ f.2.1.1 (-) Bacteriorhodopsin {Halobacterium salinarum}
rpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgygl
tmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglvga
ltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsayp
vvwligsegagivplnietllfmvldvsakvgfglillr

SCOP Domain Coordinates for d1ap9__:

Click to download the PDB-style file with coordinates for d1ap9__.
(The format of our PDB-style files is described here.)

Timeline for d1ap9__: