SCOP 1.55: Domain d1cwqb_: 1cwq B:

Lineage for d1cwqb_ (1cwq B:)

1. Root: SCOP 1.55

2. Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (10 families)

5. Family f.2.1.1: Seven-helix membrane receptors [56870] (3 proteins)

6. Protein Bacteriorhodopsin [56871] (2 species)

7. Species Halobacterium salinarum [TaxId:2242] [56873] (19 PDB entries)

8. Domain d1cwqb_: 1cwq B: [43413]

Details for d1cwqb_

PDB Entry: 1cwq, 2.25 Å

PDB Description: m intermediate structure of the wild type bacteriorhodopsin in combination with the ground state structure

SCOP Domain Sequences for d1cwqb_:

Sequence; same for both SEQRES and ATOM records:

>d1cwqb_ f.2.1.1 (B:) Bacteriorhodopsin {Halobacterium salinarum}
aqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsml
lgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigt
glvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvl
wsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapeps

Timeline for d1cwqb_:

• d1cwqb_ appears in SCOP 1.57
  
• d1cwqb_ appears in the current release, SCOPe 2.08