SCOP 1.61: Domain d1cwqa_: 1cwq A:

Lineage for d1cwqa_ (1cwq A:)

1. Root: SCOP 1.61

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (13 families)

5. Family f.2.1.1: Seven-helix membrane receptors [56870] (4 proteins)

6. Protein Bacteriorhodopsin [56871] (2 species)

7. Species Halobacterium salinarum [TaxId:2242] [56873] (26 PDB entries)

8. Domain d1cwqa_: 1cwq A: [43412]

Details for d1cwqa_

PDB Entry: 1cwq, 2.25 Å

PDB Description: m intermediate structure of the wild type bacteriorhodopsin in combination with the ground state structure

SCOP Domain Sequences for d1cwqa_:

Sequence; same for both SEQRES and ATOM records:

>d1cwqa_ f.2.1.1 (A:) Bacteriorhodopsin {Halobacterium salinarum}
aqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsml
lgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigt
glvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvl
wsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapeps

Timeline for d1cwqa_:

• d1cwqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1cwqa_ appears in SCOP 1.59
  
• d1cwqa_ appears in SCOP 1.63
  
• d1cwqa_ appears in the current release, SCOPe 2.08