Lineage for d1qkpa_ (1qkp A:)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 201495Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 201496Superfamily f.2.1: Membrane all-alpha [56869] (13 families) (S)
  5. 201497Family f.2.1.1: Seven-helix membrane receptors [56870] (4 proteins)
  6. 201498Protein Bacteriorhodopsin [56871] (2 species)
  7. 201503Species Halobacterium salinarum [TaxId:2242] [56873] (26 PDB entries)
  8. 201516Domain d1qkpa_: 1qkp A: [43411]

Details for d1qkpa_

PDB Entry: 1qkp (more details), 2.1 Å

PDB Description: high resolution x-ray structure of an early intermediate in the bacteriorhodopsin photocycle

SCOP Domain Sequences for d1qkpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qkpa_ f.2.1.1 (A:) Bacteriorhodopsin {Halobacterium salinarum}
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifge

SCOP Domain Coordinates for d1qkpa_:

Click to download the PDB-style file with coordinates for d1qkpa_.
(The format of our PDB-style files is described here.)

Timeline for d1qkpa_: