SCOP 1.63: Domain d1c3wa_: 1c3w A:

Lineage for d1c3wa_ (1c3w A:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (2 families)

5. Family f.13.1.1: Bacteriorhodopsin-like [81319] (3 proteins)

6. Protein Bacteriorhodopsin [56871] (2 species)
   a light-driven proton pump

7. Species Halobacterium salinarum [TaxId:2242] [56873] (31 PDB entries)

8. Domain d1c3wa_: 1c3w A: [43405]
   complexed with li1, ret, squ

Details for d1c3wa_

PDB Entry: 1c3w, 1.55 Å

PDB Description: bacteriorhodopsin/lipid complex at 1.55 a resolution

SCOP Domain Sequences for d1c3wa_:

Sequence; same for both SEQRES and ATOM records:

>d1c3wa_ f.13.1.1 (A:) Bacteriorhodopsin {Halobacterium salinarum}
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgfsmrpevastfkvlrnvtvvlwsaypvvw
ligsegagivplnietllfmvldvsakvgfglillrsraifg

Timeline for d1c3wa_:

• d1c3wa_ first appeared (with stable ids) in SCOP 1.55
  
• d1c3wa_ appears in SCOP 1.61
  
• d1c3wa_ appears in SCOP 1.65
  
• d1c3wa_ appears in the current release, SCOPe 2.08