Lineage for d2brd__ (2brd -)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 201495Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 201496Superfamily f.2.1: Membrane all-alpha [56869] (13 families) (S)
  5. 201497Family f.2.1.1: Seven-helix membrane receptors [56870] (4 proteins)
  6. 201498Protein Bacteriorhodopsin [56871] (2 species)
  7. 201499Species Archaeon Halobacterium halobium [TaxId:2242] [56872] (3 PDB entries)
  8. 201502Domain d2brd__: 2brd - [43403]

Details for d2brd__

PDB Entry: 2brd (more details), 3.5 Å

PDB Description: crystal structure of bacteriorhodopsin in purple membrane

SCOP Domain Sequences for d2brd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2brd__ f.2.1.1 (-) Bacteriorhodopsin {Archaeon Halobacterium halobium}
rpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgygl
tmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglvga
ltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsayp
vvwligsegagivplnietllfmvldvsakvgfglillrsra

SCOP Domain Coordinates for d2brd__:

Click to download the PDB-style file with coordinates for d2brd__.
(The format of our PDB-style files is described here.)

Timeline for d2brd__: