Lineage for d1bxla1 (1bxl A:1-209)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2250850Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2250926Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2250927Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 2250933Protein Apoptosis regulator Bcl-xL [56856] (3 species)
  7. 2250934Species Human (Homo sapiens) [TaxId:9606] [56857] (35 PDB entries)
  8. 2250981Domain d1bxla1: 1bxl A:1-209 [43396]
    Other proteins in same PDB: d1bxla2, d1bxla3

Details for d1bxla1

PDB Entry: 1bxl (more details)

PDB Description: structure of bcl-xl/bak peptide complex, nmr, minimized average structure
PDB Compounds: (A:) bcl-xl

SCOPe Domain Sequences for d1bxla1:

Sequence, based on SEQRES records: (download)

>d1bxla1 f.1.4.1 (A:1-209) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnpswhla
dspavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitpgtay
qsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndhlep
wiqenggwdtfvelygnnaaaesrkgqer

Sequence, based on observed residues (ATOM records): (download)

>d1bxla1 f.1.4.1 (A:1-209) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagdefelr
yrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemq
vlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqer

SCOPe Domain Coordinates for d1bxla1:

Click to download the PDB-style file with coordinates for d1bxla1.
(The format of our PDB-style files is described here.)

Timeline for d1bxla1: