SCOPe 2.08: Domain d1g5ja1: 1g5j A:5-213

Lineage for d1g5ja1 (1g5j A:5-213)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (51 PDB entries)

8. Domain d1g5ja1: 1g5j A:5-213 [43394]
   Other proteins in same PDB: d1g5ja2, d1g5ja3
   complex with peptide from Bad (CH B)

Details for d1g5ja1

PDB Entry: 1g5j

PDB Description: complex of bcl-xl with peptide from bad

PDB Compounds: (A:) apoptosis regulator bcl-x

SCOPe Domain Sequences for d1g5ja1:

Sequence; same for both SEQRES and ATOM records:

>d1g5ja1 f.1.4.1 (A:5-213) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagdefelr
yrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemq
vlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqer

Timeline for d1g5ja1:

• d1g5ja1 first appeared (with stable ids) in SCOP 1.55, called d1g5ja_
  
• d1g5ja1 appears in SCOPe 2.07